PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g00200.1
Common NameLR48_Vigan01g176800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 745aa    MW: 82478.5 Da    PI: 6.1884
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g00200.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.7e-085496347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
   Vang11g00200.1 54 AWTRQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 96
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-1046101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-54999IPR009057Homeodomain-like
PROSITE profilePS5129313.41650101IPR017884SANT domain
SMARTSM007172.7E-65199IPR001005SANT/Myb domain
CDDcd001676.69E-65497No hitNo description
PfamPF002495.1E-65496IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MEAEAQISHD SNTQFQPEPV VSVQKGDPGV SSSVANAVIP QQPATKKPTR QWAAWTRQEE  60
ESFFTALRQV GKNFEKITSR VQSKNKDQVR HYYYRLVRRM NKLLGPGLCL DAKNSKDTNA  120
AMLRWWSLLE KYSCKASKLH LKPRRFKIFL EALEHQLLKD RKKNVRKRPL QGGNCLPPVP  180
TTVSNQGRAS GNEARAVKLV LVDSQNILKL GPSKSSMKRN INMGVSRSNT KGDSNTMKST  240
RQRKKSGMIS TAAYRKWEKA AIAGVSLVAD AAEHLERAAT VREIEQDQEN PGEKCSDPTD  300
YVLPSLPSCP QNQFVDNNVN SMKLKLQLFP IDEPTRRALE VRWSQESTLS AADIYAMIGS  360
PPIFRLRYGW FSNSELGLLN MQVPVASGSI LTQSKXSVYN SKDQIVNSVS FPTAAANAHS  420
MELSEGCRIS MNRNHTLMTS SPGVPNTRGN SXYLNTSSEE SRHPTANTLW HXKDVGDEAV  480
TTQLEDLEEL KLSSGTGLSA GEWADSLTNI SVGDLLSGVS QDLEDDCINP PIADNCHDVQ  540
QVPFSSDSFD AAIAAHISRH QDKMGQSTLV AHMSSIWDAE ETCDAFIFRR DHILHADRPC  600
LSPVASLESE KKVPERSFEK LDELSPEREG LVDDFVQSDP MPMDSSESDA DIQDHLGKDF  660
SALADIYWPD SLGPLDLDIP SSTKYHTEDL IFSDSLSGLN RLIASSLDXF QNCSFFGFDK  720
KEAPSTVEAR ESATLSDFKI GSGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509919.10.0PREDICTED: TSL-kinase interacting protein 1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A0L9TP300.0A0A0L9TP30_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R4710.0A0A0S3R471_PHAAN; Uncharacterized protein
STRINGGLYMA16G23840.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98832531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.21e-180TSL-kinase interacting protein 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]